We are the member of the World Chemical Sourcing Alliance attaching to SACTG ( Serving Advanced Chemicals to Global Customers ). Our parent company is Chemsigma in Nanjing, China.

With a rich history of long experience ( since 2009 ) and good reputation, SACTG has become a trusted brand to manufacturers of Advanced Organic Chemicals along with our customers in North America, Europe, Japan, Korea and Singapore.

We are distributors, sourcing chemicals linking our global customers as potential buyers to manufacturers.

We have rich experience with the following product categories:

API intermediates and impurities
Biochemical chemicals
Flavors and fragrances
Materials chemicals
OLED Chemicals
Personal care chemicals
Oligonucleotide activators and sulfidizers
Enzyme assay reagents
Fluorinating reagents
Tetrazole series
High purity chemicals

We are actively seeking the following featured partners:

Factories with excess production capacity for contract manufacturing or collaboration
Research and development companies (laboratories) with unique technologies for outsourcing development
Factories or R&D companies (laboratories) capable of accepting CMO or CDMO business for custom synthesis

98823-93-9

DWLKAFYDKVAEKLKEAFPDWLKAFYDKVAEKLKEAF